PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi01g01640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB
Protein Properties Length: 400aa    MW: 44662.7 Da    PI: 7.7709
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi01g01640.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12.1e-1875122148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg WT+eEd +++ +v+ +G+g+W++++++ g++R++k+c++rw +yl
  Vradi01g01640.1  75 RGLWTPEEDAKILAYVANHGTGNWTLVPKKAGLNRCGKSCRLRWTNYL 122
                      788*******************************************97 PP

2Myb_DNA-binding47.83.4e-15130171346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++T++E+el+++++   G++ W++Iar+++ gRt++++k++w++
  Vradi01g01640.1 130 SFTPQEEELIINLHGAIGSR-WSLIARRLP-GRTDNDVKNYWNT 171
                      79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-2566125IPR009057Homeodomain-like
PROSITE profilePS5129427.37170126IPR017930Myb domain
SuperFamilySSF466892.44E-3072169IPR009057Homeodomain-like
SMARTSM007175.5E-1574124IPR001005SANT/Myb domain
PfamPF002493.3E-1775122IPR001005SANT/Myb domain
CDDcd001678.69E-1278122No hitNo description
Gene3DG3DSA:1.10.10.608.5E-24126177IPR009057Homeodomain-like
PROSITE profilePS5129418.42127177IPR017930Myb domain
SMARTSM007174.9E-14127175IPR001005SANT/Myb domain
CDDcd001677.62E-11130173No hitNo description
PfamPF002492.5E-13130171IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MNIIMQLLLL GANICMLFLP LHILNIRPFH HFKVTLQCIL HHHYIIHSAF LLFLLSLFSQ  60
KMGRPPCCDK SNVKRGLWTP EEDAKILAYV ANHGTGNWTL VPKKAGLNRC GKSCRLRWTN  120
YLRPDLKHDS FTPQEEELII NLHGAIGSRW SLIARRLPGR TDNDVKNYWN TKLRKKLMKM  180
GIDPVTHKPV SQVLSDLGSI SGFPNTTTTN QMAYVNKELV MNNMAPTKTE PSGSNKSVVE  240
NTQEGQVHSW QHHIPYQVLT TENVQSQVFS ETASSTSSSS SSNLTQLGSP QSYSCQTPQA  300
QTGPHCSSFD WSEFLHSDSF VWSLNPSSLV QSEADLSINA KTNGHDKQGV SAVEGCCGAS  360
MEYQIKKQCE GHSFVDGILD RDSELRAAFP ELLDASFDY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-29751777108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014509585.10.0PREDICTED: transcription factor MYB35
SwissprotQ9LSI71e-86MYB35_ARATH; Transcription factor MYB35
TrEMBLA0A0S3T8L10.0A0A0S3T8L1_PHAAN; Uncharacterized protein
STRINGGLYMA13G04920.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.12e-87MYB family protein